Protein Info for HP15_1522 in Marinobacter adhaerens HP15
Annotation: dihydrolipoamide acetyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to ODO2_ECO57: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Escherichia coli O157:H7
KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 93% identity to maq:Maqu_1155)MetaCyc: 59% identical to 2-oxoglutarate dehydrogenase E2 subunit (Escherichia coli K-12 substr. MG1655)
Dihydrolipoyllysine-residue succinyltransferase. [EC: 1.2.1.105, 2.3.1.61]
Predicted SEED Role
"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- superpathway of glyoxylate bypass and TCA (10/12 steps found)
- 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
- TCA cycle I (prokaryotic) (8/10 steps found)
- TCA cycle VIII (Chlamydia) (4/6 steps found)
- TCA cycle II (plants and fungi) (6/9 steps found)
- TCA cycle III (animals) (6/10 steps found)
- 2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA (2/5 steps found)
- L-tryptophan degradation III (eukaryotic) (5/15 steps found)
- L-tryptophan degradation XI (mammalian, via kynurenine) (5/23 steps found)
- superpathway of L-lysine degradation (12/43 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Lysine degradation
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.2.1.105 or 2.3.1.61
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PL78 at UniProt or InterPro
Protein Sequence (409 amino acids)
>HP15_1522 dihydrolipoamide acetyltransferase (Marinobacter adhaerens HP15) MSTEIKAPVFPESVAEGTVATWHKQPGEACSRDELIVDIETDKVVLEVVAPADGVIEEII KNEGDTVESGEVVGKFKEGAKGESKPAEGKKEESKEEAPKEEAKSEASSGEAILSPAARK LAEENNVDPNSIKGTGKDGRVTKEDVQNHVDSAKSSGGAAAPQPAAGMPEVNVSQGERPE KRVPMTRLRASIAKRLVNAQQSAAMLTTFNEVNMGPIMEMRKQYQDSFVKRHGIKLGFMS FFTKAATEALKRFPAVNASIDGNDMVYHGYQDIGVAVSTDRGLVVPVLRDSDAMGLADIE KKIVEYGTKAKEGKLAIEDMTGGTFTITNGGIFGSLISTPILNPPQTAILGMHKIQERPM AVNGKVEIQPMMYLALSYDHRMIDGKEAVQFLVAIKEMLEDPARILLDV