Protein Info for HP15_1516 in Marinobacter adhaerens HP15

Annotation: type II citrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01798: citrate (Si)-synthase
  • amino acids 12 to 421 (410 residues), 767.7 bits, E=1.2e-235
• PF00285: Citrate_synt
  • amino acids 45 to 410 (366 residues), 481.8 bits, E=6.6e-149

Best Hits

Swiss-Prot: 73% identical to CISY_PSEAE: Citrate synthase (gltA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 92% identity to maq:Maqu_1149)

MetaCyc: 66% identical to citrate synthase (Escherichia coli K-12 substr. MG1655)
Citrate (Si)-synthase. [EC: 2.3.3.1, 2.3.3.16, 2.3.3.3]

Predicted SEED Role

"Citrate synthase (si) (EC 2.3.3.1)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 2.3.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
• partial TCA cycle (obligate autotrophs) (8/8 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• glyoxylate cycle (5/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• nitrogen remobilization from senescing leaves (6/8 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• TCA cycle II (plants and fungi) (6/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• TCA cycle III (animals) (6/10 steps found)
• methylaspartate cycle (9/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.1 or 2.3.3.16 or 2.3.3.3

Sequence Analysis Tools

See E4PL72 at UniProt or InterPro

Protein Sequence (424 amino acids)

>HP15_1516 type II citrate synthase (Marinobacter adhaerens HP15)
MTDRKATLSVGDKSIELPVYSGTVGPDVIDVRGLVQEGVFTYDPGFVSTAACESAITYID
GANGVLLHRGYPIEQLAEHSDYLEVCYLLLHGELPSAEENQKFHDTIKNHTMLHDQMRNF
FQGFRRDAHPMAIMCGVVGALSAFYHGEMDVASQEQREITAHRLIAKMPTIAAWCYKYAI
GQPFIYPRNDLSYSENFLQMMFGVPCEEYKPNPILAKAMDKIFILHADHEQNASTSTVRL
AGSTGANPYACIASGIAALWGPAHGGANEAVLDMLAEIGDESNIEKFIAKAKDKDDPFRL
MGFGHRVYKNFDPRAKVMAETAHEVLTELGLENDPLLKIAQRLEKIALEDEYFVKRKLYP
NVDFYSGLILKAIGIPTSMFTVIFALSRTIGWFSHWNEMVSGDYRIGRPRQLYTGSDSRD
YPAK