Protein Info for Psest_1577 in Pseudomonas stutzeri RCH2

Annotation: Membrane glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 852 transmembrane" amino acids 144 to 162 (19 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 517 to 545 (29 residues), see Phobius details amino acids 572 to 596 (25 residues), see Phobius details amino acids 606 to 623 (18 residues), see Phobius details amino acids 628 to 647 (20 residues), see Phobius details amino acids 668 to 690 (23 residues), see Phobius details amino acids 694 to 713 (20 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 252 to 433 (182 residues), 69.2 bits, see alignment E=4.4e-23 PF13632: Glyco_trans_2_3" amino acids 348 to 564 (217 residues), 44.7 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 67% identical to OPGH_PSEFS: Glucans biosynthesis glucosyltransferase H (opgH) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 94% identity to psa:PST_2724)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK15 at UniProt or InterPro

Protein Sequence (852 amino acids)

>Psest_1577 Membrane glycosyltransferase (Pseudomonas stutzeri RCH2)
MNGVAEGYCDGLALQDVEDPARYRRTAEQGGLLALHDELSEDVREGRGSSRRLLDSVVAR
LRLGWGDLFDRAGVIAEDHQGRAYVQSTPPIVRTRMVPEPWHTNILRRGWRRMLGRTPPR
RQFEPSPQPLDEARWRRVAALRRSALLLLMLGQTAFATWQMKAVLPYQGWFLVDLQDVYV
QPLAESARQILPYVVQTSILLLFALLFCWVSVGFWTALMGFFQLLRGKDRYSISASSTGT
ETIPAEARTALVMPIANEDVPRVFAGLRATYESLKATGELEHFDIFVLSDSNDPDTCVAE
QKAWVELCRAVDGFGHIFYRRRRRRVKRKSGNIDDFCRRWGSSYRYMVVLDADSVMSGEC
LTSLVRLMEANPNAGIIQSAPKASGMDTLYARMQQFATRVYGPLFTAGLNFWQLGESHYW
GHNAIIRVKPFIEHCALAPLPGTGSFAGAILSHDFVEAALMRRAGWGVWIAYDLPGSYEA
LPPNLLDELKRDRRWCHGNLMNFRLFMVRGVHTVHRLVFLTGVMSYLSAPLWFLFLLLST
GLLAIHTLMEPEYFLQPNQLYPLWPRWHPEEAIALFSATMTLLFLPKLLSVLLICIQGAQ
AYGGRLRLLLSMLIETLFSVLLAPVRMLFHSVFVTAAFLGWSVQWNSPQRGDDATPWGEA
LRRHGSQIVIGVLWTALVAWLDAAFLWWLAPIVVSLMLSAPVSVITSRTGLGLAARRRQL
FLIPEEYAPPTELANTDLYQQQNQANALREGFLVAVVDPLYNALVCAMARARHAKVVPAA
DHLREQRLAEVLAAGPSGEKAEAARWRLLNDPDGMALLHQYAWDDPAGGTWLARYRKQYP
HGVSRGELTEPR