Protein Info for Psest_1576 in Pseudomonas stutzeri RCH2

Annotation: Periplasmic glucans biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF04349: MdoG" amino acids 35 to 518 (484 residues), 643.1 bits, see alignment E=1.6e-197

Best Hits

Swiss-Prot: 70% identical to OPGG_PSEAE: Glucans biosynthesis protein G (opgG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03670, periplasmic glucans biosynthesis protein (inferred from 93% identity to psa:PST_2725)

Predicted SEED Role

"Glucans biosynthesis protein G precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJF4 at UniProt or InterPro

Protein Sequence (523 amino acids)

>Psest_1576 Periplasmic glucans biosynthesis protein (Pseudomonas stutzeri RCH2)
MLRIFQWKTGSQSARMLAGLAGGLCMLLAGNALAFGLDDVAERAQALAASGYEEPVSNLP
AELRKMAFADYQRLRFNPEHAYWKDAETPFHLQFYHQGMHFDTPVRINEITATDVREIRY
DPAMFQFDGVEIDPAALEGLGFAGFKVLYPLNKKDKQDEVMTLLGASYFRIIGKGQWYGL
SARGLAIDTALPVGEEFPRFREFWVERPQADRRNLVIYALLDSPRATGAYRMVLTPGKDS
TLDVQAKVYLREPVGKLGIAPLTSMFLFGANQPSDSLNFRPQLHDSEGLAIHAGNGEWLW
RPLNNPKRLAVSAFSVENPRGFGLMQRTRDFNRYEDLDDRYELRPSGWVETRGDWGKGHV
ELVEIPTPDETNDNIVAFWSPEKQPEPGQSLDLEYRLHFSMDEPSLHDPKLAWVQQTRVS
AGDVKQANLIRQPDGSTALIVDFVGPVLEQLAEDAPVTTRVSIDDNAELVENNLRYNTVT
KGWRLTLRLKVRDPARPVEMRAALVDGEKTLSETWTYQIPPHE