Protein Info for HP15_1487 in Marinobacter adhaerens HP15

Annotation: transcriptional regulator, BadM/Rrf2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR00738: Rrf2 family protein" amino acids 1 to 118 (118 residues), 131.9 bits, see alignment E=6.9e-43 PF02082: Rrf2" amino acids 1 to 118 (118 residues), 117.5 bits, see alignment E=2.4e-38

Best Hits

Swiss-Prot: 63% identical to YOR2_AZOVI: Putative HTH-type transcriptional regulator ORF2 from Azotobacter vinelandii

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 88% identity to maq:Maqu_1121)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKF4 at UniProt or InterPro

Protein Sequence (152 amino acids)

>HP15_1487 transcriptional regulator, BadM/Rrf2 family (Marinobacter adhaerens HP15)
MLDLALHGDQGPVSLADISARQEISLSYLEQLFSRLRRQKLVVSIRGPGGGYRLSRPAAD
LYIAEVVDAVSESLDTTRCGNKGDCQNGEKCLTHHLWSDLSDQIHQFLSEISLGDLMRKH
EIRQVADRQNRRQSDSGSETINTERLSDQAPA