Protein Info for Psest_1559 in Pseudomonas stutzeri RCH2

Annotation: universal bacterial protein YeaZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ
  • amino acids 4 to 215 (212 residues), 219.3 bits, E=2.9e-69
• PF00814: TsaD
  • amino acids 31 to 150 (120 residues), 103.1 bits, E=1.1e-33

Best Hits

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 92% identity to psa:PST_2743)

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

See L0GLA8 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Psest_1559 universal bacterial protein YeaZ (Pseudomonas stutzeri RCH2)
MTTLLALDTATEACSVALLHDGKVLSHYEVIPRLHAQRLLPMVQTLLGEAGVALSAVDAI
AFGRGPGAFTGVRIAIGVVQGLAFALQRPVLPVSTLATIAQRAWREHGAAQVAAAIDARM
DEVYWGCYREQGGEMQLLGSEAVLPPEQAVLPRAADGEWFGAGTGWGYAERIPSAVRASD
AGMLPHAEDLLHLATFAWQRGEALEADQAQPVYLRDNVATPKGIK