Protein Info for Psest_1548 in Pseudomonas stutzeri RCH2

Annotation: peptide chain release factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR00020: peptide chain release factor 2" amino acids 1 to 362 (362 residues), 529.2 bits, see alignment E=2.4e-163 PF03462: PCRF" amino acids 31 to 219 (189 residues), 183.6 bits, see alignment E=3.7e-58 PF00472: RF-1" amino acids 227 to 336 (110 residues), 146.6 bits, see alignment E=2.9e-47

Best Hits

Swiss-Prot: 70% identical to RF2_YERP3: Peptide chain release factor 2 (prfB) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 96% identity to pfv:Psefu_1157)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH93 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Psest_1548 peptide chain release factor 2 (Pseudomonas stutzeri RCH2)
MEINPILNSIKDLSERTLSIRGYLDYDQKHDRLVEVNRELEDPNVWNKPEYAQSLGRERA
TLAQIVETIDDLTGSLADSRDLLDMAAEENDEGAVNDIVAEVERLREILEKLEFRRMFSH
EMDPNNCYLDIQAGSGGTEAQDWANILLRMYLRWADKRGFSAEIVELSEGEVAGIKGATV
HIKGEYAFGWLRTEIGVHRLVRKSPFDSGARRHTSFSAVFVSPEIDDKVEIEINPADLRI
DTYRSSGAGGQHVNTTDSAVRITHVPTNTVVACQNERSQHANKDTAMKMLRARLYEQEMQ
KRNAASQALEDTKSDIGWGHQIRSYVLDDSRIKDLRTGVERSDCQKVLDGDLDGYLEASL
KQGL