Protein Info for Psest_1547 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details PF04391: DUF533" amino acids 54 to 233 (180 residues), 224.2 bits, see alignment E=4.7e-71

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_2756)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJY7 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Psest_1547 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MKTSGLLDQLLKSGQDLLQKQQSGMGGKPGGGGLSDLLSGVGGGSLGKVLSGSGNSALAA
GAMGLLLGNRKVRKMGGKAVTYGGLAALGVLAYKAYSNWQAQQGGTQQQTPQTIDRLPPA
EVEVHSQGILKALVAAAKADGHVDARERQLIEAELGKLADADLQHWLEAELNKPLDPADV
ASSASTPELAAEMYLASVLMVDEEHFMERAYLDELARCLQLDPDLKAELESQVRGVSA