Protein Info for Psest_0151 in Pseudomonas stutzeri RCH2

Annotation: Response regulator with putative antiterminator output domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF08376: NIT" amino acids 39 to 283 (245 residues), 179.9 bits, see alignment E=1.1e-56 PF03861: ANTAR" amino acids 364 to 416 (53 residues), 60.7 bits, see alignment 9.3e-21

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_4091)

Predicted SEED Role

"Response regulator NasT" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDE4 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Psest_0151 Response regulator with putative antiterminator output domain (Pseudomonas stutzeri RCH2)
MHGRKMPATLRFMLASRRSELLGLEDLARTCELVTRISQLVHALQKERGYSNIYLSGNAA
HQRQQLDVLSLEAEALERDVRLDLDRIDLDAVSSAEKTRLFTRIAYALHSLDELPALRRR
IREHAISMQDATATLVRLIGGLLAVVFEAADTAADPDITRCLVALFNFMQGKELAGQERA
LGVVGFASGYFRADMLERLEHLLEGQERCFATFSRFASPAAQALWQALCASETNINACRL
RDIARRTSPGAAVEPQLCELWFELHTHRIDAMKQVETRLEQDLLQQCRYSIERIRKDLQS
HRKLLDGIADMHAAAEQAKLFSVQASDLDAPPPDGMTAMVARSTLELLLTQSVRLQGLNE
ELREARQALDERKQVERAKQQLMRQQGFSEGEAYSWLRQAAMNQGLRLEEVAQRLLALAQ
PADHAPARTLGQRSRH