Protein Info for PGA1_c15230 in Phaeobacter inhibens DSM 17395

Annotation: rRNA methyltransferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF22458: RsmF-B_ferredox" amino acids 130 to 197 (68 residues), 54.2 bits, see alignment E=2e-18 PF01728: FtsJ" amino acids 225 to 366 (142 residues), 25.2 bits, see alignment E=2.2e-09 PF01189: Methyltr_RsmB-F" amino acids 226 to 380 (155 residues), 111.1 bits, see alignment E=8.5e-36

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 59% identity to rsq:Rsph17025_2376)

Predicted SEED Role

"Sun protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ELW6 at UniProt or InterPro

Protein Sequence (403 amino acids)

>PGA1_c15230 rRNA methyltransferase-like protein (Phaeobacter inhibens DSM 17395)
MTPAARRQAAIEILDHILTGEPAEKALTAWARRSRFAGSKDRAAVRDHVFAALRCLRSYA
ALGGGGGAGEISDSNTTGRQLMLGALRAEGVDVAEIFSGVGHAPAPLEPAEEAAISTAPQ
MQPTEVLDIPDWLWPAFAASLGDAAEAAARALQQRAPVHLRVNQRKTDRDAALIALSEEG
ILAEAHPAADTALSVTEGARKLRNSSAYLTGLVELQDAASQAVIEALPLADGQRVLDFCA
GGGGKSLAIAARGNLAVFAHDIAPQRMKDLPARADRAGAAITVLAPDDVAAKAPFDLVLC
DAPCSGSGSWRRAPEGKWRLTQARLDDLCQTQAQILNDASQLVATGGTLAYATCSMLNAE
NCDQVAAFLARNPNWQLQQDHGWQVHGGTDGFYVAVLSRFGDD