Protein Info for Psest_1540 in Pseudomonas stutzeri RCH2

Annotation: biotin-dependent carboxylase uncharacterized domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR00724: biotin-dependent carboxylase uncharacterized domain" amino acids 5 to 296 (292 residues), 246.5 bits, see alignment E=1.7e-77 PF02626: CT_A_B" amino acids 25 to 284 (260 residues), 267.7 bits, see alignment E=6.5e-84

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_2763)

Predicted SEED Role

"Allophanate hydrolase 2 subunit 2 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL22 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Psest_1540 biotin-dependent carboxylase uncharacterized domain (Pseudomonas stutzeri RCH2)
MSLLIEQAGALATLQDAGRSGVRQLGVTQGGAVDWLSHGWANWLLGNPQQASTVEITLGN
FSLRAQADTCLALCGADLGATLDGEPLMPGRAFSIRQGQTLIFSQPRQGVRAYLAAPGGF
SAPEVLGSSATVRREQLGGLNGDGQPLAKGDLLHWRGHATTMRTLPELPLVPPPGIGLSV
VLGAQIGDFTGQSLFDAFNSDWTVDQRADRMGVRLLGPPLRCARSSMISEGVPLGAIQVP
ADGQPIVLLNDRQTIGGYPRLGALTPQAVAQLAQCLPGTTLRLKPIALEAAQRQHKALLG
QWQ