Protein Info for PGA1_c15200 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): ATP-dependent reduction of co(II)balamin (RamA-like) (EC:2.1.1.13)
Rationale: Apparently required for the reactivation of vitamin B12. Distantly related to RamA (see PMID: 19043046) (auxotroph)
Original annotation: Uncharacterized metal-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17650: RACo_linker
  • amino acids 136 to 227 (92 residues), 111.3 bits, E=3.2e-36
• PF17651: Raco_middle
  • amino acids 231 to 387 (157 residues), 163.6 bits, E=6.2e-52
• PF14574: RACo_C_ter
  • amino acids 396 to 666 (271 residues), 291.5 bits, E=9.4e-91

Best Hits

KEGG orthology group: None (inferred from 88% identity to sil:SPO2041)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-methionine biosynthesis I (4/5 steps found)
• L-methionine salvage from L-homocysteine (2/3 steps found)
• folate transformations I (9/13 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.13

Use Curated BLAST to search for 2.1.1.13

Sequence Analysis Tools

See I7EZ64 at UniProt or InterPro

Protein Sequence (698 amino acids)

>PGA1_c15200 ATP-dependent reduction of co(II)balamin (RamA-like) (EC:2.1.1.13) (Phaeobacter inhibens DSM 17395)
MANDPAPEISTETATDPASHPLVVFTPSGKRGRFPVGTPVLTAARQLGVDLDSVCGGRGI
CSKCQITPSYGEFSKHGVTVADDALTEWNKVEQRYKDKRGLIDGRRLGCQAQVQGDVVID
VPPESQVHRQVVRKRAEARDITMNPSTRLYYVEVEEPDMHKPTGDMERLIEALDAQWDLK
GVKTDLHILSVLQPALRKGGWKVTVAVHLGDENHPPKIMHIWPGFYEGSIYGLAVDLGST
TIAAHLCDLKTGDVVASSGIMNPQIRFGEDLMSRVSYSMMNKGGDQEMTRAVREGMNALF
TQIAAEAEIDKALIVDAVFVCNPVMHHLFLGIDPFELGQAPFALATSNALALRAVELDLN
IHPAARVYLLPCIAGHVGADAAAVALSEAPDKSEDLVLVVDVGTNAEILLGNKDKVLACS
SPTGPAFEGAQISSGQRAAPGAIERVEINPETKEPRFRVIGSDIWSDEDGFAAAVATTGI
TGICGSGIIEAIAEMRMAGLLDASGLIGSAEQTGTTRCIQDGRTNAYLLWDGSVEGGPTI
TVTNPDIRAIQMAKAALYSGARLLMDKFGIDTVDRVVLAGAFGAHISAKHAMVLGMIPDC
PLDKVTSAGNAAGTGARIALLNTEARSEIEATVQQIEKIETAVEPRFQEHFVNASAIPNS
AEPFPILSSIVTLPEANFNTGGGDGNEVGGRRRRRRRG