Protein Info for Psest_0150 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details PF13379: NMT1_2" amino acids 53 to 312 (260 residues), 357.7 bits, see alignment E=2.2e-111

Best Hits

Swiss-Prot: 60% identical to NRTA_NOSS1: Nitrate/nitrite binding protein NrtA (nrtA) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 98% identity to psa:PST_4092)

Predicted SEED Role

"Nitrate ABC transporter, nitrate-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG69 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Psest_0150 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components (Pseudomonas stutzeri RCH2)
MTDKPNNDQPSSVTLASRRSFLKQSIIAASGVALFGGMSLGMRSAAWAAGGDVETSKAKL
GFIALTDAAPLFVAAEKGLFAKYGMTEVEVLKQSSWGTTRDNLVLGSAKNGIDGAHILTP
MPYLISAGIVTPNNQPVAMSILARLNLAGQCISVGEEYRDLKIGLDSTPFKAALEAKKAS
GKKVSAAMTFPGGTHDLWMRYWLAAGGIDPNADINTIVVPPAQMVANMKVGSMDTFCVCE
PWNAQLINQKIGYTANTTGELWHNHPEKAFALRSDYVATNPNAAKALTMAIMEAQQFCEK
AENKEEVAKICSQRKWIGAPYKDIVDRMKGNFAYGTGKVIENHPEQMRYWDDHASYPFQS
HDLWFLTENKRWGYLPTDFDSQALIAKVNREDIWRAAAGELNLPAELIPTSTSRGVEKFF
DGKVFDPENPQAYLDSLTIKAMA