Protein Info for PGA1_c15170 in Phaeobacter inhibens DSM 17395

Annotation: 6-phosphogluconolactonase Pgl

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR01198: 6-phosphogluconolactonase" amino acids 6 to 221 (216 residues), 143.7 bits, see alignment E=3.4e-46 PF01182: Glucosamine_iso" amino acids 8 to 221 (214 residues), 170.4 bits, see alignment E=2.8e-54

Best Hits

Swiss-Prot: 38% identical to 6PGL_CAUVC: 6-phosphogluconolactonase (pgl) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 66% identity to sil:SPO2047)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ELW0 at UniProt or InterPro

Protein Sequence (223 amino acids)

>PGA1_c15170 6-phosphogluconolactonase Pgl (Phaeobacter inhibens DSM 17395)
MNIIEYADRDMLAIDVANQLAGDLKTHLLHHDSASFAVAGGTTPAPVFDDLCAADIDWKR
VRLMATDERWVPSDSERSNARMIRERLLVNRAAAAQFVPFHIPARAPEDVLAEVESLIEP
DLPLSVVLLGMGEDMHTASLFPGVRGLSEALAADAPVLAVMRPDSQPEPRVSLSARVLDA
AIAKHLVIYGEAKREALETAKSLPPEEAPIQAVLSEMTVHWAP