Protein Info for Psest_1530 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 67 to 99 (33 residues), see Phobius details PF05437: AzlD" amino acids 3 to 100 (98 residues), 83.7 bits, see alignment E=4.2e-28

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_2775)

Predicted SEED Role

"branched-chain amino acid transport"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJX5 at UniProt or InterPro

Protein Sequence (108 amino acids)

>Psest_1530 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MSTWLLIFGMLAITFVTRYSFFAWPDLRFPRAIEQGLHYVPVAVLTAIVVPGMLMPEGAW
ALHWDNAYLLAGLLAIAIAALTRNLLATIAGGLLSFFLLRWALGQLPI