Protein Info for Psest_1529 in Pseudomonas stutzeri RCH2

Annotation: Predicted branched-chain amino acid permease (azaleucine resistance)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 53 to 78 (26 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 186 to 202 (17 residues), see Phobius details amino acids 208 to 224 (17 residues), see Phobius details PF03591: AzlC" amino acids 16 to 158 (143 residues), 154.3 bits, see alignment E=1.4e-49

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_2776)

Predicted SEED Role

"AzlC family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJB6 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Psest_1529 Predicted branched-chain amino acid permease (azaleucine resistance) (Pseudomonas stutzeri RCH2)
MSRSQEFAHGCRDILPLILGAIPFGVIFGTLAVAAGLSGWQTMGMSSLVFAGSAQFIAVT
LITGGVGAAVVLLTTFVVNLRHALYSAALQPFVRHLPGRWRVPLAFWLTDEAFAVVQNRY
ARDDGSPYKHWFFLGAALTMYISWQLATLAGVAFGRAVPDLASWGLDFAMIATFIGIAVP
MMRTRPQVASALVAGAVALLTWDLPYKLGLLAAAMAGIVVGVWLERRAEAAARLEGAL