Protein Info for Psest_1526 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 305 to 322 (18 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details PF02308: MgtC" amino acids 9 to 134 (126 residues), 60.7 bits, see alignment E=1.8e-20 PF13194: DUF4010" amino acids 182 to 389 (208 residues), 226.8 bits, see alignment E=2.5e-71

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_2780)

Predicted SEED Role

"FIG00956950: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH76 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Psest_1526 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MTLELFLNLATALAVGLLIGTERTWSGRDNAGQELVAGIRTFGLAGLFGGLAAVSINHLG
ALAWVAMFGMLALLVIAGYVIDAHRSGDYGMTTEVALLLTFVLGSLAVAESRELAAACAI
VVALLLSLKARLHQALKRLSEAELAGALKMLFISVVLLPALPNQGYGPWQALNPYTTWMM
VVLIAGIGFAAYVAIRFFGARHGLLLTALLGGIVSSTAMTITLARLNAPQLRAALAAGLL
ATSALMFPRVLLEVGLVNPALLPGLALPLACAGAIYAAGALFYYLRAGETPDDNPEPLLK
NPFELGPALRFAALLVLILLLVEGARHWLGDAGIYLVSLVAGLTDVDAITLSLASKAHDG
LSHEVAIRGIVFAALSNSLVKAMLIVLIGGRELALRTLPIMFAGLLTGLAVLLLR