Protein Info for HP15_1451 in Marinobacter adhaerens HP15

Annotation: ABC-type uncharacterized transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF04392: ABC_sub_bind" amino acids 29 to 320 (292 residues), 336.1 bits, see alignment E=8.8e-105

Best Hits

KEGG orthology group: K01989, putative ABC transport system substrate-binding protein (inferred from 82% identity to maq:Maqu_1089)

Predicted SEED Role

"ABC transporter substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKB8 at UniProt or InterPro

Protein Sequence (324 amino acids)

>HP15_1451 ABC-type uncharacterized transport system, periplasmic component (Marinobacter adhaerens HP15)
MAKTTLRTLFGATLLALATLVQAQEPRVVAITQIVEHPALDAVYQGIKDELAERGFKEGD
NLEVMHESAQGNSAIASQIARKFVGESPDVIVAIATPSAQTVAAAARNTPVIFSAVTDPL
GAKLVSNLEAPGANITGVSDMLPIDKHLDMLQRVMPDAKRIGTVYNPGEANAVSLVELLE
ERLSARGLELVKGAATKTSEVLGAARSLVGKADAIYLTTDNTVISAAEAVISVGERASIP
VFAADTATVERGAVAALGFDYYDHGRQTGVMVARVLNGEKPGEMAVETMEKLDLFVNPAA
AERMGITLSDDVIADAKKVIDSAK