Protein Info for HP15_1450 in Marinobacter adhaerens HP15

Annotation: inner-membrane translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 176 to 201 (26 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 259 (247 residues), 85.1 bits, see alignment E=2.3e-28

Best Hits

KEGG orthology group: K05832, putative ABC transport system permease protein (inferred from 91% identity to maq:Maqu_1088)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKB7 at UniProt or InterPro

Protein Sequence (300 amino acids)

>HP15_1450 inner-membrane translocator (Marinobacter adhaerens HP15)
MLSNIALYGAIETGLIYGLVAFGIYLSFRVLDFPDLTVDGSFPLGAAVAAVLIIEGWNPW
LATGCAVMAGMAAGAVTALLNVKLNILNLLASILTMIALYSVNLRIMGRPNVALLTEETV
LTPWYDLDLAYHQVPVLLFVIVVFVALILLWRFMKSETGLAMRATGANARMARAQGIATG
AMIVLGVAVSNGLVGLAGALFAQSQGAADVTMGVGVIVIGLASLIGGEAVVTPSTVVRAL
IACVVGAIIYRLAIAFALNADFLGLQAQDLNLITAVLVTLAIVLPGVRSSIAGKLSRSKA