Protein Info for HP15_1446 in Marinobacter adhaerens HP15

Annotation: ribonucleotide reductase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF12637: TSCPD" amino acids 60 to 157 (98 residues), 36.5 bits, see alignment E=2.5e-13

Best Hits

KEGG orthology group: None (inferred from 92% identity to maq:Maqu_1084)

Predicted SEED Role

"Ribonucleotide reductase of class II (coenzyme B12-dependent), alpha subunit (EC 1.17.4.1)" (EC 1.17.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKB3 at UniProt or InterPro

Protein Sequence (232 amino acids)

>HP15_1446 ribonucleotide reductase, alpha subunit (Marinobacter adhaerens HP15)
MTVKISNKIVGYRVKKADPEAAAEHQAPVHAETKPVQMNEYIERPDFLLGTTYKIKPPVA
EHAMYITINDILLNEGTDHESRQPYEVFINSKSMEHFQWVIALTRVISAVFRKGGDVTFL
VEELRSVYDPNGGYFKKGGVFMPSLVAEIGAVIEKHLKAIGLLESEEMSETTKRILAEKR
AEFEASHSTATNDEKASDFPPNATMCGKCSTKAVIVMDGCATCLSCGDSKCG