Protein Info for Psest_1517 in Pseudomonas stutzeri RCH2

Annotation: phosphoribosylaminoimidazole-succinocarboxamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 80% identical to PUR7_CHRVO: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 98% identity to psa:PST_2788)

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
inosine-5'-phosphate biosynthesis I (6/6 steps found)
inosine-5'-phosphate biosynthesis II (5/5 steps found)
inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL04 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Psest_1517 phosphoribosylaminoimidazole-succinocarboxamide synthase (Pseudomonas stutzeri RCH2)
MTTPTALSLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILAEPIPEKGKILTAISNF
WFDKLKGLIPNHFTGDKVEDVVPADELALVEGRAVVAKRLKPVAVEAIVRGYIVGSGWKE
YQKSGTVCGIQLPAGLKEAAKLPQPIFTPSTKAAVGDHDENISFEQCQAIIGSELAAQVR
DVSIALYSAAVEYAATRGIIIADTKFEFGLDEDGTLTLMDEVLTPDSSRFWPADSYEEGK
NPPSFDKQFVRDWLESTGWNKQPPAPAVPADVAQKTADKYREALTRLTA