Protein Info for Psest_1514 in Pseudomonas stutzeri RCH2

Annotation: Glycine cleavage system regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF13740: ACT_6" amino acids 10 to 81 (72 residues), 55.4 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: K03567, glycine cleavage system transcriptional repressor (inferred from 88% identity to pfl:PFL_1456)

Predicted SEED Role

"Glycine cleavage system transcriptional antiactivator GcvR" in subsystem Glycine cleavage system or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJW3 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Psest_1514 Glycine cleavage system regulatory protein (Pseudomonas stutzeri RCH2)
MSTPPVPREQFLVISALGANPMELTNVLCRAANENRCAVVSTRLTRHGECSALVLEVTGS
WDALARMETTLPGLAKKHAFTSNVVRSEALETRPQALPYVAYVSAAFRPDILNELCQFFI
DHRVELESLTCDTYQAPQTGGTMLNATLTVTLPAGTQISWLRDQFLDFADALNLDALIEP
WRPQNP