Protein Info for Psest_1509 in Pseudomonas stutzeri RCH2

Annotation: quinolinate synthetase complex, A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 29 to 341 (313 residues), 369.9 bits, see alignment E=4.8e-115 PF02445: NadA" amino acids 33 to 339 (307 residues), 354.4 bits, see alignment E=2.3e-110

Best Hits

Swiss-Prot: 90% identical to NADA_PSEMY: Quinolinate synthase A (nadA) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 90% identity to pmk:MDS_1316)

MetaCyc: 71% identical to quinolinate synthase (Escherichia coli K-12 substr. MG1655)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJV8 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Psest_1509 quinolinate synthetase complex, A subunit (Pseudomonas stutzeri RCH2)
MTQIPERILVQAHLAAKQPKPLTPEQEAQLRSEIAVELKRQNAVLVAHYYTDPVIQALAE
ETGGCVSDSLEMARFGNEHPAQTVLVAGVKFMGETAKILNPEKRVLMPTLEATCSLDLGC
PVDEFSAFCDQHPERTVVVYANTSAAVKARADWVVTSSCALEIVESLMDNGEKIIWAPDK
HLGNYVQRETGADILLWDGACIVHEEFKAKQLADMKALYPDAAILVHPESPQAVVELADA
VGSTSQLIKAAQTLPQQTLIVATDRGIFYKMQQLCPEKTFIEAPTAGQGASCRSCAHCPW
MAMNTLERTLECLRAGSNEIFVDPALIPRAVKPLKRMLDFTQAARLKQAGNA