Protein Info for Psest_1508 in Pseudomonas stutzeri RCH2

Annotation: succinate CoA transferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02550: AcetylCoA_hydro
  • amino acids 11 to 215 (205 residues), 91.8 bits, E=1.2e-29
• TIGR03458: succinate CoA transferase
  • amino acids 11 to 494 (484 residues), 764.8 bits, E=1.8e-234
• PF13336: AcetylCoA_hyd_C
  • amino acids 320 to 463 (144 residues), 138.4 bits, E=3.9e-44

Best Hits

Swiss-Prot: 51% identical to CAT1_CLOK5: Succinyl-CoA:coenzyme A transferase (cat1) from Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

KEGG orthology group: None (inferred from 98% identity to psa:PST_2797)

MetaCyc: 51% identical to succinyl-CoA:CoA transferase (Clostridium kluyveri)
RXN-8807 [EC: 2.8.3.18]

Predicted SEED Role

"Acetyl-CoA hydrolase"

MetaCyc Pathways

• TCA cycle VII (acetate-producers) (8/9 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• acetate formation from acetyl-CoA (succinate) (1/1 steps found)
• pyruvate fermentation to acetate VI (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• succinate fermentation to butanoate (2/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.18

Sequence Analysis Tools

See L0GJA2 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Psest_1508 succinate CoA transferases (Pseudomonas stutzeri RCH2)
MYSDRIRLSSLQNKVMSAHEAAALIRDGMTVGMSGFTRAGEAKAVPLALIDRAKDEKLQI
SLVTGASLGNDLDGKMASAGLLARRMPFQADPVLRKAINAGEVMFIDQHLSHTVEQMRNH
QIKRPDVTIIEALCITEQGHIVPTTSVGNSANLAMFADQVIIELNLAHNLNLEGLHDIYF
PGERPNRGPIPLTQVDDRIGTAAIPVDPAKIAAIVITNQPDSYSTVTPPDEETQAIANHL
VEFFKSEVAAGRMAKNLGPMQVGIGNIANAVMCGLIDSPFEDLVMYSEVLQDCTFELIDA
GKMSFASGCSITLSERCNDRVFGNLEKYKDKLVLRPQEISNHPELVRRLGIIGINTALEF
DIYGNVNSTHVGGTKMMNGIGGSGDFARNAHMAVFVTKSIAKGGNISSVVPMVAHVDHTE
HDVEILVTEQGLADLRGLAPRERARVIIDNCVHPSYRDVLNKYFEDACKKGGQTPHLLGE
AMQWHINLEERGHMLKGE