Protein Info for HP15_1435 in Marinobacter adhaerens HP15

Annotation: thioesterase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF03061: 4HBT" amino acids 23 to 96 (74 residues), 68.5 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 50% identical to VDLD_HELPJ: Protein VdlD (vdlD) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: None (inferred from 74% identity to pfv:Psefu_0113)

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKA2 at UniProt or InterPro

Protein Sequence (159 amino acids)

>HP15_1435 thioesterase superfamily protein (Marinobacter adhaerens HP15)
MENNSTSLSMTVLMTPDKANFSGNVHGGTLLKYLDEVAYACASRYAGTYVVTLSVDQVMF
LQPIQIGELVTFLASVNYTGRTSMEIGIKVVTENIRDKLVRHSNSCFFTMVAVDDNGKAV
AVPQLVPSTDDQIRRFANGKERRAIRAELEERYKALHKK