Protein Info for PGA1_c01510 in Phaeobacter inhibens DSM 17395

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 TIGR00484: translation elongation factor G" amino acids 1 to 704 (704 residues), 1051 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 10 to 293 (284 residues), 216 bits, see alignment E=1.1e-67 TIGR00231: small GTP-binding protein domain" amino acids 11 to 190 (180 residues), 107.3 bits, see alignment E=6.7e-35 PF22042: EF-G_D2" amino acids 324 to 406 (83 residues), 71.3 bits, see alignment E=1.8e-23 PF03144: GTP_EFTU_D2" amino acids 338 to 405 (68 residues), 70.7 bits, see alignment E=3.4e-23 PF14492: EFG_III" amino acids 418 to 491 (74 residues), 113.1 bits, see alignment E=1.5e-36 PF03764: EFG_IV" amino acids 493 to 611 (119 residues), 153.3 bits, see alignment E=7.5e-49 PF00679: EFG_C" amino acids 615 to 700 (86 residues), 98.5 bits, see alignment E=5.7e-32

Best Hits

Swiss-Prot: 94% identical to EFG_RUEST: Elongation factor G (fusA) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02355, elongation factor G (inferred from 94% identity to sit:TM1040_0241)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWT1 at UniProt or InterPro

Protein Sequence (706 amino acids)

>PGA1_c01510 elongation factor G (Phaeobacter inhibens DSM 17395)
MAREYPLELYRNFGIMAHIDAGKTTCSERILYYTGKSHNIGEVHDGAATMDWMEQEQERG
ITITSAATTTFWERTEDGETADSPKHRLNIIDTPGHVDFTIEVERSLAVLDGAVCVLDAN
AGVEPQTETVWRQADRYKVPRMVFVNKMDKIGADFFNCVNMIEDRTGARAVPVGIPIGAE
TELEGLVDLVNMEEWLWQGEDLGASWIKAPIRDSLKDMADEWRGKMIEAAVEQDDAAMEN
YLMDGAEPDVATLRALLRKGTLALDFVPVLGGSAFKNKGVQPLLNAVIDYLPSPLDVVDY
MGFKPGDETETRDIARRADDDMAFSGLAFKIMNDPFVGSLTFTRIYSGVLNKGDTLLNST
KGRKERVGRMMMMHSNDREEITEAFAGDIIALAGLKDTTTGDTLCAVNDPVVLETMTFPD
PVIEIAVEPKTKADQEKMSQGLQRLAAEDPSFRVETDIESGQTIMKGMGELHLDILVDRL
KREFKVEANIGAPQVAYRETIGHEVEHTYTHKKQSGGSGQFGEVKMIISPTEPGEGYSFE
SRIVGGAVPKEYIPGVEKGVQSVMDSGPLAGFPVIDFKVALIDGKFHDVDSSVLAFEIAA
RMCMREGMRKAGAKMLEPIMKVEVITPEDYTGGIIGDLTSRRGQVTGQEPRGNAIAIDAF
VPLANMFGYINTLRSMSSGRAQFTMQFDHYDPVPQNISDEIQAKFA