Protein Info for PGA1_c14880 in Phaeobacter inhibens DSM 17395

Annotation: putative 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01488: Shikimate_DH" amino acids 2 to 47 (46 residues), 26.5 bits, see alignment 1.8e-09 PF03807: F420_oxidored" amino acids 3 to 66 (64 residues), 40.3 bits, see alignment E=1.2e-13 PF03446: NAD_binding_2" amino acids 3 to 160 (158 residues), 171 bits, see alignment E=6.4e-54 PF14833: NAD_binding_11" amino acids 166 to 284 (119 residues), 122.5 bits, see alignment E=3.6e-39

Best Hits

Swiss-Prot: 63% identical to Y1503_SHEFN: Uncharacterized oxidoreductase Sfri_1503 (Sfri_1503) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 84% identity to sil:SPO0792)

MetaCyc: 32% identical to 2-(hydroxymethyl)glutarate dehydrogenase subunit (Eubacterium barkeri)
2-hydroxymethylglutarate dehydrogenase. [EC: 1.1.1.291]

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.291 or 1.1.1.31 or 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E0E8 at UniProt or InterPro

Protein Sequence (290 amino acids)

>PGA1_c14880 putative 3-hydroxyisobutyrate dehydrogenase (Phaeobacter inhibens DSM 17395)
MAKVAFLGLGVMGYPMAGHLAAAGHEVTVYNRTAAKAEAWAKEHGGTAAATPREAAAGAE
FVMACVGNDDDLRSVCLGDTGAFGGMGAGAIFVDHTTVSAKVTRELNAAAADLGLSFVDA
PISGGQAGAENGVLSVMCGGDQAAYDKAEPVIGSYARICRRIGDSGAGQMTKMCNQIAIA
GLVQGLSEALHFAEKAGLDGRAVVEVISQGAAGSWQMANRHETMLDDHFDHGFAVDWMRK
DLGICLDAAEETGASLPVTALVDQFYKDVQKLGGGRWDTSSLFKRLKAFE