Protein Info for Psest_1504 in Pseudomonas stutzeri RCH2

Annotation: tol-pal system protein YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 62 to 116 (55 residues), 41 bits, see alignment E=6.9e-14 TIGR02795: tol-pal system protein YbgF" amino acids 152 to 269 (118 residues), 137.3 bits, see alignment E=1.8e-44 PF13525: YfiO" amino acids 152 to 268 (117 residues), 25.9 bits, see alignment E=3.2e-09 PF13174: TPR_6" amino acids 156 to 185 (30 residues), 16.2 bits, see alignment (E = 5.6e-06) amino acids 191 to 221 (31 residues), 17.3 bits, see alignment 2.4e-06 amino acids 227 to 259 (33 residues), 30.9 bits, see alignment 1.1e-10 PF09976: TPR_21" amino acids 156 to 254 (99 residues), 28.4 bits, see alignment E=5.2e-10 PF13432: TPR_16" amino acids 157 to 221 (65 residues), 32.2 bits, see alignment E=4.8e-11 PF14559: TPR_19" amino acids 200 to 269 (70 residues), 33.9 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 62% identical to CPOB_PSEPK: Cell division coordinator CpoB (cpoB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 91% identity to psa:PST_2801)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH56 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Psest_1504 tol-pal system protein YbgF (Pseudomonas stutzeri RCH2)
MRKYRHALTFTVLGLPLYGVAQVPVVDYEQGAASGNSGYSTAAPSGDGAYAGGGAAAPSS
AQGMLFMQLQQMQEEIAQLRGMLEEQQNQIQRLQQEGLERYQDLDRRLSSGSAAGSNQSA
PSRDEPSIAGNTGAPAASPGRTQGGSSDPAQEKLYYDAAFDLIKAKDFDKASQAFAAFLR
KYPDSQYAGNAQYWLGEVNLAKGDLQGAGQAFARVSQAYPQHNKVPDSLYKLADVEIRLG
NRDKAQGILRQVIAQYPNTSAAQLAQRQLNR