Protein Info for Psest_1500 in Pseudomonas stutzeri RCH2

Annotation: TolR protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details PF02472: ExbD" amino acids 8 to 144 (137 residues), 100.3 bits, see alignment E=4.4e-33 TIGR02801: protein TolR" amino acids 11 to 144 (134 residues), 150.5 bits, see alignment E=2e-48

Best Hits

Swiss-Prot: 80% identical to TOLR_PSEAE: Tol-Pal system protein TolR (tolR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03560, biopolymer transport protein TolR (inferred from 98% identity to psa:PST_2805)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL57 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Psest_1500 TolR protein (Pseudomonas stutzeri RCH2)
MARIRNRRKPVAEMNVVPYIDVMLVLLVIFMVTAPMLNQGVKVDLPKVSSEALPQDNDKQ
VLTISIKADKTYYWNVGSEVDTESKGNEAVALADMTQAVVAIMRQRPDTQVFIRGDRAVD
YGSVMAAMGGLQEAGVGNVGLITEAP