Protein Info for Psest_1495 in Pseudomonas stutzeri RCH2

Annotation: crossover junction endodeoxyribonuclease RuvC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 TIGR00228: crossover junction endodeoxyribonuclease RuvC" amino acids 4 to 155 (152 residues), 200.5 bits, see alignment E=7.2e-64 PF02075: RuvC" amino acids 4 to 150 (147 residues), 211 bits, see alignment E=3.7e-67

Best Hits

Swiss-Prot: 98% identical to RUVC_PSEU5: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 98% identity to psa:PST_2810)

MetaCyc: 59% identical to crossover junction endodeoxyribonuclease RuvC (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10 or 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL54 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Psest_1495 crossover junction endodeoxyribonuclease RuvC (Pseudomonas stutzeri RCH2)
MTLILGIDPGSRITGYGVVRDTGRGCEYVASGCIRTGTGELPERLRAVFSGVSEVIRTYG
PVTMGIEQVFMARNADSALKLGQARGAAIVAGAEAGLQIAEYTATQVKQAIAGTGGADKQ
QVQMMVMHLLKLLEKPQIDASDALAIALCHAHHRQSLIPHGLVGAKRRGGRLRL