Protein Info for HP15_1420 in Marinobacter adhaerens HP15

Annotation: putative amino acid ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 73 to 104 (32 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 111 (99 residues), 96.6 bits, see alignment E=5.2e-32 PF00528: BPD_transp_1" amino acids 35 to 217 (183 residues), 68.1 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 31% identical to GLNP_BACSU: Probable glutamine ABC transporter permease protein GlnP (glnP) from Bacillus subtilis (strain 168)

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 77% identity to pin:Ping_1516)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK87 at UniProt or InterPro

Protein Sequence (221 amino acids)

>HP15_1420 putative amino acid ABC transporter permease protein (Marinobacter adhaerens HP15)
MDYEFHWNVVFQNMPQLLNGAFVTLHVSVLAMLLGVVIAILLAIAKMNNTKFFSQVATVW
VEIARNTPALFQIYMAYFGLGAFGIHLSPYVAVLSALVFINAGYLTETFRGGFQSIPSTQ
YSASKSLGMTSIQTYRYIILPQMLRRIYHPMTNQFVWSILMSSLGILVGMSELSGTTQRL
QSLSFRTLEFFIVAAVMYFVITKLVLFGSSLLARRLFKGEI