Protein Info for HP15_1419 in Marinobacter adhaerens HP15

Annotation: ABC transporter periplasmic amino acid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 34 to 257 (224 residues), 107.4 bits, see alignment E=4.8e-35 PF09084: NMT1" amino acids 86 to 220 (135 residues), 32.9 bits, see alignment E=6.5e-12

Best Hits

KEGG orthology group: K10039, putative glutamine transport system substrate-binding protein (inferred from 74% identity to pin:Ping_1517)

Predicted SEED Role

"ABC transporter, substrate binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK86 at UniProt or InterPro

Protein Sequence (272 amino acids)

>HP15_1419 ABC transporter periplasmic amino acid-binding protein (Marinobacter adhaerens HP15)
MIRKLAPLVFACAAVTSVSATADQLDTVIQRGTLNCGVVLDFPPMGYFDENNEPAGFDVD
YCNDLGEALGVDVNVLNLTWGERIPSLVSGKTDVVIGSTSDTLERAKTVGFTYPYFVFKF
QVIANEDKNIESFDDLKNLKVGAALGTTYETEYLAYAEQQGWGKDNYTSFKSENDAYLGL
YQGKVDAIISTNTNIATKLRSEEFADFEAGPYVPNYDDVVGIIAKRDEVAWINYLNLFLV
RQIRDGNMNEAYNKHFGTDAPADLIKSLRDNK