Protein Info for HP15_1415 in Marinobacter adhaerens HP15

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 876 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 158 to 283 (126 residues), 68.1 bits, see alignment E=7.7e-23 PF00989: PAS" amino acids 161 to 274 (114 residues), 35.3 bits, see alignment E=3.7e-12 PF08448: PAS_4" amino acids 168 to 277 (110 residues), 31.4 bits, see alignment E=6.7e-11 PF13426: PAS_9" amino acids 171 to 276 (106 residues), 34.2 bits, see alignment E=8.9e-12 PF13185: GAF_2" amino acids 307 to 445 (139 residues), 38.7 bits, see alignment E=4.1e-13 PF01590: GAF" amino acids 311 to 444 (134 residues), 22.7 bits, see alignment E=4.4e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 453 to 615 (163 residues), 118.1 bits, see alignment E=3.2e-38 PF00990: GGDEF" amino acids 458 to 613 (156 residues), 141.9 bits, see alignment E=5.4e-45 PF00563: EAL" amino acids 635 to 864 (230 residues), 263.7 bits, see alignment E=4.8e-82

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJJ3 at UniProt or InterPro

Protein Sequence (876 amino acids)

>HP15_1415 diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s) (Marinobacter adhaerens HP15)
MSIGTALCFGLIGAAWMATVLPVRHSTIALQVLALTVFTISGSALTGYVFGIQQFELTIF
STMALHTSLLFVLCSTAMLLVRPNEGIMASATSPYVGGRSVRKLLPFIIVTPILMCWLSL
KGLQAGYYSEAFGFAISAVSSILVLSFVGWFGADALNREEERFRSTIDSSPVATVMVDQA
GIIQMANQLAHSLFLYPRNHLVGKPLESLLPLRFREEHSVFVRGFMNAPQQRMMGEGREL
FALRHDDSEFPAEIALNPVHTVEGRYIMASVMDITERLKAEEKILRLNRIHKVLSGINTL
IVRVQTRKALFEEATRLTVEEGELLAAMIVEYNHDSGQGTVLNQHAANNKFSNRPLSKAE
TAIVGECLQNHRIVIKNELRKPDYNRGFNDLINLGVGALVAFPLTHRDQELQVALLLYRE
DAFSFDQAEMRLLNEVAGDISFAIANLAKSHQLEYLTHFDSVTELPNRLLFTDRLQQAIL
QAEWRKNVFSILYVDIDRFRQVNDSLGHTVGDYVLCKVAERILACVAEADTVARWGGDEF
IVLLPDRSGADASEIATCINGQLHSVISLENGRELFVSCSMGIAECDGTGIDVDVLINRA
RTAMATIKEQGGNDYRHFIASDHGTLSDALALETSLRHALEERQLELYYQPQIDIASRQL
VGLEALLRWQHPTEGLVPPDHFIPLAEKTGLIIPIGKWVLYEACRQAAAIPGLRVAVNLS
ARQFHQENLVTVVQEVLDKTGMPPAYLELEITESALIYEVEAAIDTMSQLSSLGVSISLD
DFGTGYSSLSYLKRFPIDTLKIDKSFINEVTTDPGSEVIANTIIAMAHSLNLKVIAEGVE
TEEQLAMLRERECDQAQGYLIARPMPFSEVIAKFQL