Protein Info for PGA1_c14680 in Phaeobacter inhibens DSM 17395

Annotation: lipoyl synthase LipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16881: LIAS_N
  • amino acids 32 to 81 (50 residues), 32.3 bits, 1.1e-11
• TIGR00510: lipoyl synthase
  • amino acids 37 to 328 (292 residues), 367 bits, E=3.7e-114
• PF04055: Radical_SAM
  • amino acids 96 to 260 (165 residues), 64.3 bits, E=1.7e-21

Best Hits

Swiss-Prot: 92% identical to LIPA_RUEST: Lipoyl synthase (lipA) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 92% identity to sit:TM1040_1371)

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.8

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

See I7E0C8 at UniProt or InterPro

Protein Sequence (338 amino acids)

>PGA1_c14680 lipoyl synthase LipA (Phaeobacter inhibens DSM 17395)
MPSDCNYVTKTKRPLPQGNIDVRDLKIPEQRHPEKAHRPDNAQPKKPSWIRVKAPGGKGY
AETHKIMREHKLVTVCEEAGCPNVGECWSQGHATMMIMGEVCTRACSFCNIATGKPPEAL
DVFEPGRVADAVQKLGLNHVVITSVDRDDIEDGGAEHFAQTIRAVRHRSPKTTIEILTPD
FLKCDPSVLEKVVEARPDVFNHNLETVPGLYPEVRAGARYFHSLRLLQRVKELDPSMFTK
SGIMVGLGEDAQAVKQVMDDMRAADIDFLTIGQYLQPTPKHHAVDRFVTPEEFESYEKAA
YGKGFLMVSATPLTRSSYHAGDDFAQLRAARNKKLGLA