Protein Info for Psest_1480 in Pseudomonas stutzeri RCH2

Annotation: arsenate reductase (glutaredoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 57% identical to YFGD_ECOLI: Uncharacterized protein YfgD (yfgD) from Escherichia coli (strain K12)

KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 80% identity to pen:PSEEN1354)

MetaCyc: 45% identical to arsenate reductase (Escherichia coli K-12 substr. MG1655)
Arsenate reductase (glutaredoxin). [EC: 1.20.4.1]

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

arsenate detoxification III (2/2 steps found)
arsenic detoxification (bacteria) (2/4 steps found)
arsenate detoxification I (3/6 steps found)
arsenic detoxification (plants) (3/6 steps found)
arsenic detoxification (yeast) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL43 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Psest_1480 arsenate reductase (glutaredoxin) (Pseudomonas stutzeri RCH2)
MATSSGETQLQMTELTLYHNPRCSKSRGALELLEARGLSPEIVRYLETPPSAAELCALLD
KLGLTARQLLRTGEEEYKSLNLANPELSEAELIDAMIEHPRLIERPILIAGNKAIIGRPP
EKVLEILP