Protein Info for Psest_1478 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details PF09842: DUF2069" amino acids 24 to 125 (102 residues), 105.8 bits, see alignment E=6.2e-35

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_2827)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJT0 at UniProt or InterPro

Protein Sequence (136 amino acids)

>Psest_1478 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MAKKRKPLPSLDWLTPRVKASRAISLASFFGLAALLTVWNLVFADLHGARTWVVVSIQLI
PLLLVAPGMITGSPRAHAWLCFIVNLYFIQGVLAAIDPARMIYGLLEAAISMTLFVAALL
YTRWSYQYERKAMGEA