Protein Info for PGA1_c14520 in Phaeobacter inhibens DSM 17395

Annotation: 30S ribosomal protein S9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF00380: Ribosomal_S9" amino acids 41 to 161 (121 residues), 165.2 bits, see alignment E=4.1e-53

Best Hits

Swiss-Prot: 80% identical to RS9_RHOS4: 30S ribosomal protein S9 (rpsI) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K02996, small subunit ribosomal protein S9 (inferred from 92% identity to sit:TM1040_1384)

Predicted SEED Role

"SSU ribosomal protein S9p (S16e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZ10 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PGA1_c14520 30S ribosomal protein S9 (Phaeobacter inhibens DSM 17395)
MADQINTLEELGAVAGVETVAEETISREPVRDELGRAYATGKRKDAVARVWIKPGSGKVS
VNGKELNTYFARPVLQMILRQPFQVAGVEGEFDVYATVKGGGLSGQAGAVKHGISKALQL
YNPSLRGALKAAGFLTRDSRVVERKKFGRRKARRSFQFSKR