Protein Info for HP15_1399 in Marinobacter adhaerens HP15

Annotation: metal-dependent hydrolase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13483: Lactamase_B_3" amino acids 44 to 271 (228 residues), 40.3 bits, see alignment E=5.1e-14 PF12706: Lactamase_B_2" amino acids 52 to 271 (220 residues), 44.2 bits, see alignment E=2.6e-15

Best Hits

KEGG orthology group: None (inferred from 61% identity to eba:ebD64)

Predicted SEED Role

"putative metal-dependent hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJH7 at UniProt or InterPro

Protein Sequence (321 amino acids)

>HP15_1399 metal-dependent hydrolase-like protein (Marinobacter adhaerens HP15)
MAFAGVSVCMLFGAAMPAAADDHVVKVTPLGSHDGEFCGRDRALVFEDPNGTRILYDAGR
TVAGPDDPRLGKIDVVLVSHMHGDHVGDQRISKTNQGTCGSPDTGVSTLPQSNTVDIAVK
HGSKIVTGSEMPAFFAAKLKDAGGDPANSLLVRFGGEREVGGVAITTVPAVHSNGVSPSF
LTGPLAEYLAAAGVGASVGPPTGYVLRFSNGLVVYLSGDTGITAEQRLVVKDHYGAGLVV
MNIGDTFTTGPKQAAYVINDLVQPKAVIASHANEPATSGGMVQEGTRTALFRDSVTVPVH
VPLSGRTMAFNGMASCVSGCN