Protein Info for PGA1_c01470 in Phaeobacter inhibens DSM 17395

Annotation: Permeases of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 25 (14 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details PF00892: EamA" amino acids 10 to 143 (134 residues), 35.2 bits, see alignment E=7.2e-13 amino acids 154 to 281 (128 residues), 37 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: None (inferred from 63% identity to sil:SPO3504)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVR8 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PGA1_c01470 Permeases of the drug/metabolite transporter (DMT) superfamily (Phaeobacter inhibens DSM 17395)
MISRLTGNQLGALLMVGSMAGFTLNDGMVKLAGQSLPLSQILVVRGVAVSLLIYALARSY
GGLRLSLSRRDWALVAGRSLAEIATTYFFLSALLTLPIANVTAILQMLPLTVTLAAALLF
GEQVGWRRATAIGVGFFGMLLIVRPGADGFDTGTGYALAAVICITARDLFTRRMSAAVPS
LTVTLMAAVSVLMFGLGLGLQETWQPLTLSTTLILLLAAGCIFIGYLFSVMVMRVGDVAA
VSPFRYTGLLWALLLGWLMFDNWPDTLTLIGAAIVVAAGIFSLLRERPRRAATPDLSPPE