Protein Info for Psest_1463 in Pseudomonas stutzeri RCH2

Annotation: SufE protein probably involved in Fe-S center assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF02657: SufE" amino acids 13 to 132 (120 residues), 133.4 bits, see alignment E=1.8e-43

Best Hits

Swiss-Prot: 37% identical to SUFE_CROS8: Cysteine desulfuration protein SufE (sufE) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K02426, cysteine desulfuration protein SufE (inferred from 81% identity to psa:PST_2841)

MetaCyc: 42% identical to sulfur acceptor protein CsdE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE, sulfur acceptor protein CsdE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJR7 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Psest_1463 SufE protein probably involved in Fe-S center assembly (Pseudomonas stutzeri RCH2)
MTGLPQTAAEALNAFTQAAGWEQRARLLMQWGERLEPLDDSERSEANLVSGCESHVWLIG
TPHAGRWHFRASSDARLIRGLLAVLLARVNGLDAGELAAVDMAEWFNSLGLSRQLSPSRS
NGMTAVLRRMRELTGCCGQR