Protein Info for Psest_1462 in Pseudomonas stutzeri RCH2

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 351 to 370 (20 residues), see Phobius details PF08545: ACP_syn_III" amino acids 150 to 231 (82 residues), 64.3 bits, see alignment E=1.2e-21 PF08541: ACP_syn_III_C" amino acids 283 to 371 (89 residues), 66 bits, see alignment E=4.3e-22

Best Hits

Swiss-Prot: 78% identical to BEKAS_PSEAE: Beta-ketodecanoyl-[acyl-carrier-protein] synthase (PA3286) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 96% identity to psa:PST_2842)

MetaCyc: 78% identical to beta-ketodecanoyl-[acyl-carrier-protein] synthase (Pseudomonas aeruginosa PAO1)
RXN-13613 [EC: 2.3.1.207]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.207

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ68 at UniProt or InterPro

Protein Sequence (373 amino acids)

>Psest_1462 3-oxoacyl-[acyl-carrier-protein] synthase III (Pseudomonas stutzeri RCH2)
MYNVVISGTGLYTPASSISNDELVESFNIYVQRFNSENAAAIEAGEIQPLPESSSAFIEK
ASGIKSRYVTDKAGILDPERMVPRIPERSNEQWSILCEMSVKAAEEALARAGKTAADIDG
VIVACSNLQRAYPAIAIEVQAALGIKGFGFDMNVACSSATFGIQNAVNSIKLGQARAILM
VNPEICTGHMNFRDRDSHFIFGDACTAVIIEREDLATSEHQWEVLSTKLVTEFSNNIRNN
FGFLNRAAEEHMNDPDKLFIQEGRKVFKEVCPMVAELIGEHLGENGIAVESVKRFWLHQA
NLNMNHLIVRKLLGRDATEQEAPVILDTYANTSSAGSVIAFHKHQDDLPSGSLGVLSSFG
AGYSIGSVILRKR