Protein Info for HP15_1385 in Marinobacter adhaerens HP15

Annotation: ABC transporter ATP-binding protein-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00005: ABC_tran" amino acids 35 to 181 (147 residues), 125.7 bits, see alignment E=1.1e-40

Best Hits

Swiss-Prot: 58% identical to YBBA_ECOLI: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Escherichia coli (strain K12)

KEGG orthology group: K02003, (no description) (inferred from 86% identity to maq:Maqu_1045)

MetaCyc: 50% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJG3 at UniProt or InterPro

Protein Sequence (242 amino acids)

>HP15_1385 ABC transporter ATP-binding protein-like protein (Marinobacter adhaerens HP15)
MNQMTNVNPDSQSPMLRVDNLTHRVSVETDTLTILQGVTLEINRGESVAIVGRSGSGKTT
LLGLLAGLDTPSEGTVELDGSVISKLSEDERAKLRAHRVGFVFQSFQLLPALTALENVML
PLELAGMASPEKRARELLERVGLGERLTHTPRQLSGGEQQRVAIARAFASEPLILFADEP
TGNLDNRTGQAVSDLLMALNREQGTTLVMVTHDEHLAARCNRQFHIEAGVLTEPEAAQEM
AH