Protein Info for Psest_0142 in Pseudomonas stutzeri RCH2

Annotation: Micrococcal nuclease (thermonuclease) homologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00565: SNase" amino acids 45 to 139 (95 residues), 72.4 bits, see alignment E=2e-24

Best Hits

Swiss-Prot: 38% identical to Y1296_HAEIN: Uncharacterized endonuclease HI_1296 (HI_1296) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 78% identity to psa:PST_4100)

Predicted SEED Role

"micrococcal nuclease (SNase-like)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH55 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Psest_0142 Micrococcal nuclease (thermonuclease) homologs (Pseudomonas stutzeri RCH2)
MQRYLFAALLITTMPVSAEVITCRVIGIADGNAFSCRTAEGQRLRVRMAEIDAPDLKQPY
GSQARQTLSSHVFGKDVFLTIKGRDEQGRTLARVRAGDVDVNSDMVRTGTAWAYRGQLND
RTLLDLEAVAREFKRGIWSLHKSEQQPPWEWRKQTRSAAR