Protein Info for Psest_1455 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details PF05230: MASE2" amino acids 17 to 104 (88 residues), 89.5 bits, see alignment E=1.2e-29 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 185 to 346 (162 residues), 168.9 bits, see alignment E=3.9e-54 PF00990: GGDEF" amino acids 189 to 343 (155 residues), 139.3 bits, see alignment E=1e-44

Best Hits

KEGG orthology group: None (inferred from 52% identity to pfl:PFL_4532)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL24 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Psest_1455 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MNLSAVATRPGPSFAVRAFFPRAIGLAVGFICVAVVLLDRQTPGWVWGLLVGFCFIWPSL
ALSLSQRARSATISERRFVLFDSLMGGFWVATMGFNVLPSAMLVSMMAMNNTATGGARFV
LQGLLAQLIGAGLSVLVLGFEFSPYTSQLQMYACLPMLVVHPLTIGMVLYRLASQLGENK
RALRSLSRTDSLTGLFNRGYWNELLQLEFAHCRATRGVASLALIDLDNFKLVNDRHGHVI
GDELLRQVGQCIRRNLRAEDMPGRYGGDEFCVVLPGARAQDAWEVLERLRTEIAALDFPL
APMLSASLSIGIAECDPRMSDVLAWVHAADSALYDAKRLGRNRISLAQPLQREDAAVALA
AD