Protein Info for Psest_1454 in Pseudomonas stutzeri RCH2

Annotation: ybaK/ebsC protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 59% identical to YBAK_ECOLI: Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (ybaK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to psa:PST_2848)

MetaCyc: 59% identical to Cys-tRNAPro/Cys-tRNACys deacylase YbaK (Escherichia coli K-12 substr. MG1655)
3.1.1.M26 [EC: 3.1.1.M26]

Predicted SEED Role

"Cys-tRNA(Pro) deacylase YbaK"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.M26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH14 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Psest_1454 ybaK/ebsC protein (Pseudomonas stutzeri RCH2)
MTPAIDLLKKARAEHAVHSYEHDPKSASYGLEAAEKLGLEPARVFKTLLACSEKNELLVA
VVPVAGTLDLKALAQAAGVKKVEMADPMAAQRATGYLVGGISPLGQKKRLRTFLDSSAQA
HATIYVSAGRRGLEVELAPAVLAEHTKAMFAAIGRA