Protein Info for PGA1_c14340 in Phaeobacter inhibens DSM 17395

Annotation: tRNA-specific 2-thiouridylase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF03054: tRNA_Me_trans" amino acids 22 to 220 (199 residues), 231.4 bits, see alignment E=1.6e-72 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 22 to 377 (356 residues), 317.1 bits, see alignment E=6.1e-99 PF20259: tRNA_Me_trans_M" amino acids 236 to 290 (55 residues), 71.8 bits, see alignment 5.5e-24 PF20258: tRNA_Me_trans_C" amino acids 298 to 377 (80 residues), 57.4 bits, see alignment E=3.1e-19

Best Hits

Swiss-Prot: 94% identical to MNMA_RUEPO: tRNA-specific 2-thiouridylase MnmA (mnmA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 94% identity to sil:SPO1677)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWH3 at UniProt or InterPro

Protein Sequence (381 amino acids)

>PGA1_c14340 tRNA-specific 2-thiouridylase MnmA (Phaeobacter inhibens DSM 17395)
MAQDAHPQLNSLGFAKPPAETRVVVAMSGGVDSSVVAAHLADEGYDVVGVTLQLYDHGAA
LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC
NERVKFKDLLETARDLEADCMATGHYIQRKDGPNGPELHSAEDANRDQSYFLFSTTPEQL
DYLRFPLGHLPSKDATREMASQYGLAVADKPDSQDICFVPNGDYASVIEKLRPGAAEPGE
IVHSDGRVLGTHDGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDTKQVVVGPKELLATRTI
PVREINWLGDEPFTSRDEWHLKVKVRSTRPPRDAIIRPISETEAEVELLTPEEGISPGQA
CVFYAEEGSRIFGGGWIWRGY