Protein Info for Psest_1449 in Pseudomonas stutzeri RCH2

Annotation: Short-chain dehydrogenases of various substrate specificities

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 303 to 321 (19 residues), see Phobius details PF08659: KR" amino acids 10 to 169 (160 residues), 47.2 bits, see alignment E=4.9e-16 PF00106: adh_short" amino acids 11 to 196 (186 residues), 160.5 bits, see alignment E=7.4e-51 PF13561: adh_short_C2" amino acids 15 to 228 (214 residues), 118.1 bits, see alignment E=9.3e-38

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_2853)

Predicted SEED Role

"Oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH09 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Psest_1449 Short-chain dehydrogenases of various substrate specificities (Pseudomonas stutzeri RCH2)
MAHGNLYGALVVLTGASSGIGRAAAQAFARQGARLVLAARDAEALAETADECRALGGEVL
VVPTDVTHSDEVEALASAAAEFGQGRIDVWINNAGIGAVGAFDETPLDAHEQVVQTDLLG
YLRGAHVVLPYFKQQQSGVLINTLSVGSWVAQPFAAAYSASKFGLRGLSQALRGELGAWP
GIHICDVYPGIVDTPGFRDGGNYAGRSLQPPPPLLDPRDVANAMVSLALHPRHTTSVGAT
ATLLRLAHFLTPGFDRLNGLLTGFALGRAQRVAPSSGNLFHPPLGQRRIDGGWRSSPDDD
KRWLLIGGIAVGLIGLGVRLARRR