Protein Info for HP15_1374 in Marinobacter adhaerens HP15

Annotation: glutathione synthase/ribosomal protein S6 modification enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 PF14401: RLAN" amino acids 43 to 199 (157 residues), 163.9 bits, see alignment E=4.1e-52 PF02655: ATP-grasp_3" amino acids 307 to 479 (173 residues), 28.3 bits, see alignment E=3.4e-10 PF08443: RimK" amino acids 309 to 485 (177 residues), 44 bits, see alignment E=4e-15 PF07478: Dala_Dala_lig_C" amino acids 332 to 482 (151 residues), 32.6 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 89% identity to maq:Maqu_1035)

Predicted SEED Role

"ribosomal protein S6 glutaminyl transferase related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJF2 at UniProt or InterPro

Protein Sequence (515 amino acids)

>HP15_1374 glutathione synthase/ribosomal protein S6 modification enzyme (Marinobacter adhaerens HP15)
MATITTGKTFQGGMPSMSRLLIVVDRAKDWAPYYPSEDVLTFDQYLQFSAPPASRVRVIN
LCQSARYLSKGYYCSLLAEARGHHVVPSVMTLNDLGRKGLFSLELEELDESVINWLEAAG
SAIDPASDERAATHEVRIRTYFGQAEHPDLKPVARALFERFPCPILEIVFKRRKQWQIES
MKPAAPADLGEQEQDVFAAALDRFSSMVWRKPRARRRYRYDLAVLVNPDEEMPPSDKVAL
KRFEKAGRKLGINVEQITRRDYMRLPEYDGLFIRETTAIDHHTYRFARKAAAEGMVVIDD
PVSILKCTNKVFLADLLKNNKVPTPKTLILSKDQKNAVEQVISELGFPVVIKIPDGAFSR
GVTKAEDEKTLRAGLRDLFKQSALVLAQEYLYTDYDWRIGVLGGRAIYACKYMMVKGHWQ
IYQHSESESESGGFETMPTYEVPRNVIQAALNATRLIGNGLYGVDIKQSGNRVAVIEVND
NPSIDAGVEDCFLGGELYTLIMQEFLSRMEENRRR