Protein Info for PGA1_c14210 in Phaeobacter inhibens DSM 17395

Annotation: uridylate kinase PyrH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02075: UMP kinase
  • amino acids 16 to 248 (233 residues), 322.4 bits, E=8.6e-101
• PF00696: AA_kinase
  • amino acids 17 to 226 (210 residues), 96.7 bits, E=9.1e-32

Best Hits

Swiss-Prot: 89% identical to PYRH_RUEPO: Uridylate kinase (pyrH) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K09903, uridylate kinase [EC: 2.7.4.22] (inferred from 89% identity to sil:SPO1662)

MetaCyc: 47% identical to UMP kinase (Escherichia coli K-12 substr. MG1655)
Cytidylate kinase. [EC: 2.7.4.14, 2.7.4.22]

Predicted SEED Role

"Uridine monophosphate kinase (EC 2.7.4.22)" (EC 2.7.4.22)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• CMP phosphorylation (2/2 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.14

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.22

Sequence Analysis Tools

See I7E079 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PGA1_c14210 uridylate kinase PyrH (Phaeobacter inhibens DSM 17395)
MPLTNDQPEATPAATYKRVMLKISGEALMGDQGYGLHPPTVQRIAHEVKSVRDMGVEICM
VIGGGNIFRGLSGSAQGMERTTADYMGMLATVMNALAMQSALEGLGVFTRVISAIRMDEV
AEPYIRRRAVRHLEKKRVCIFAAGTGNPYFTTDTAATLRANEMACEAIFMGKNGVDGVYD
KDPAQHDDAVRYEDITYDEVLAKRLKVMDASAIALARDNNLPLMVFPLDEPGGFRGILAG
KGTYTKVHG