Protein Info for Psest_1437 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in archaea

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05618: RimB-like" amino acids 29 to 162 (134 residues), 121.6 bits, see alignment E=1.2e-39

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_2865)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ47 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Psest_1437 Uncharacterized protein conserved in archaea (Pseudomonas stutzeri RCH2)
MASRLLALPAALLLSLTTLPSLAAEGTPLGWVERGLILPEQVTVKFKLDTGALTSSMHAE
DVDYFEKDGDKWVRFDLDLKDVEHDKLVKSRIERKLQRELTVRGAGGKEDRPVVLMKVCV
GDRLLEEEFSLRDRDEMNYPVLLGRRTLEKLGPVDSARTFTIEPNCSELASR